| Name | Alas1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54668 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ALAS1(aminolevulinate, delta-, synthase 1) The peptide sequence was selected from the N terminal of ALAS1 (NP_000679). Peptide sequence ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALAS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |