VPS4A Antibody
| Name | VPS4A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54618 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VPS4A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: VPS4A Antibody [NBP1-54618] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24767_VPS4A%2520Antibody-Western%2520Blot-NBP1-54618-img0006.jpg)
![Immunohistochemistry: VPS4A Antibody [NBP1-54618] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24768_VPS4A-Antibody-Immunohistochemistry-NBP1-54618-img0005.jpg)