NELF Antibody

Name NELF Antibody
Supplier Novus Biologicals
Catalog NBP1-54813
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the N terminal of NELF. Peptide sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NSMF
Conjugate Unconjugated
Supplier Page Shop

Product images