PIWIL1/HIWI Antibody

Name PIWIL1/HIWI Antibody
Supplier Novus Biologicals
Catalog NBP1-54796
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIWIL1(piwi-like 1 (Drosophila)) The peptide sequence was selected from the middle region of PIWIL1. Peptide sequence LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIWIL1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.