| Name | PIWIL1/HIWI Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54796 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIWIL1(piwi-like 1 (Drosophila)) The peptide sequence was selected from the middle region of PIWIL1. Peptide sequence LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIWIL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |