GCAP1 Antibody

Name GCAP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54868
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GUCA1A
Conjugate Unconjugated
Supplier Page Shop

Product images