NELF Antibody

Name NELF Antibody
Supplier Novus Biologicals
Catalog NBP1-54835
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the middle region of NELF. Peptide sequence RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene NSMF
Conjugate Unconjugated
Supplier Page Shop

Product images