RRAD Antibody
| Name | RRAD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58864 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RRAD(Ras-related associated with diabetes) The peptide sequence was selected from the middle region of RRAD. Peptide sequence LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RRAD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RRAD Antibody [NBP1-58864] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7218_RRAD-Antibody-Western-Blot-NBP1-58864-img0004.jpg)
![Western Blot: RRAD Antibody [NBP1-58864] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7219_RRAD-Antibody-Western-Blot-NBP1-58864-img0003.jpg)