RAB23 Antibody

Name RAB23 Antibody
Supplier Novus Biologicals
Catalog NBP1-58855
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB23(RAB23, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB23. Peptide sequence TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB23
Conjugate Unconjugated
Supplier Page Shop

Product images