CHIA Antibody

Name CHIA Antibody
Supplier Novus Biologicals
Catalog NBP1-58988
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the middle region of CHIA. Peptide sequence GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHIA
Conjugate Unconjugated
Supplier Page Shop

Product images