CHIA Antibody
| Name | CHIA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58987 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the N terminal of CHIA. Peptide sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CHIA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14255_CHIA-Antibody-Western-Blot-NBP1-58987-img0004.jpg)
Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
![Western Blot: CHIA Antibody [NBP1-58987] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14256_CHIA-Antibody-Western-Blot-NBP1-58987-img0002.jpg)
Western Blot: CHIA Antibody [NBP1-58987] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14257_CHIA-Antibody-Western-Blot-NBP1-58987-img0003.jpg)
Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14258_CHIA%2520Antibody-Western%2520Blot-NBP1-58987-img0005.jpg)
Western Blot: CHIA Antibody [NBP1-58987] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.