SELS Antibody

Name SELS Antibody
Supplier Novus Biologicals
Catalog NBP1-59042
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SELS(selenoprotein S) The peptide sequence was selected from the middle region of SELS. Peptide sequence PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene VIMP
Conjugate Unconjugated
Supplier Page Shop

Product images