PTPLAD1 Antibody

Name PTPLAD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59028
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTPLAD1(protein tyrosine phosphatase-like A domain containing 1) The peptide sequence was selected from the N terminal of PTPLAD1. Peptide sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HACD3
Conjugate Unconjugated
Supplier Page Shop

Product images