Pinin Antibody

Name Pinin Antibody
Supplier Novus Biologicals
Catalog NBP1-59136
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to PNN(pinin, desmosome associated protein) The peptide sequence was selected from the N terminal of PNN. Peptide sequence MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PNN
Supplier Page Shop

Product images