PARVB Antibody

Name PARVB Antibody
Supplier Novus Biologicals
Catalog NBP1-59129
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Zebrafish
Antigen Synthetic peptides corresponding to PARVB(parvin, beta) The peptide sequence was selected from the N terminal of PARVB. Peptide sequence LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PARVB
Supplier Page Shop

Product images