Protocadherin-8 Antibody

Name Protocadherin-8 Antibody
Supplier Novus Biologicals
Catalog NBP1-59272
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDH8
Conjugate Unconjugated
Supplier Page Shop

Product images