SSPN Antibody

Name SSPN Antibody
Supplier Novus Biologicals
Catalog NBP1-59207
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SSPN(sarcospan (Kras oncogene-associated gene)) The peptide sequence was selected from the middle region of SSPN. Peptide sequence AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SSPN
Conjugate Unconjugated
Supplier Page Shop

Product images