SNRPB Antibody

Name SNRPB Antibody
Supplier Novus Biologicals
Catalog NBP1-57215
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SNRPB(small nuclear ribonucleoprotein polypeptides B and B1) The peptide sequence was selected from the N terminal of SNRPB. Peptide sequence DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SNRPB
Conjugate Unconjugated
Supplier Page Shop

Product images