SMARCA6 Antibody
| Name | SMARCA6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57145 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HELLS(helicase, lymphoid-specific) The peptide sequence was selected from the middle region of HELLS. Peptide sequence QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HELLS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SMARCA6 Antibody [NBP1-57145] - MCF7, Antibody Dilution: 1.0 ug/ml HELLS is supported by BioGPS gene expression data to be expressed in MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7189_SMARCA6%2520Antibody-Western%2520Blot-NBP1-57145-img0004.jpg)
![Western Blot: SMARCA6 Antibody [NBP1-57145] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7190_SMARCA6-Antibody-Western-Blot-NBP1-57145-img0003.jpg)