NELF-E Antibody

Name NELF-E Antibody
Supplier Novus Biologicals
Catalog NBP1-57196
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RDBP(RD RNA binding protein) The peptide sequence was selected from the N terminal of RDBP. Peptide sequence LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NELFE
Conjugate Unconjugated
Supplier Page Shop

Product images