SHPRH Antibody
| Name | SHPRH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57190 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SHPRH(SNF2 histone linker PHD RING helicase) Antibody(against the N terminal of SHPRH. Peptide sequence SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SHPRH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SHPRH Antibody [NBP1-57190] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15935_SHPRH%2520Antibody-Western%2520Blot-NBP1-57190-img0002.jpg)
Western Blot: SHPRH Antibody [NBP1-57190] - Hela cell lysate, concentration 0.2-1 ug/ml.