Xrn1 Antibody

Name Xrn1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57281
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to XRN1(5'-3' exoribonuclease 1) The peptide sequence was selected from the middle region of XRN1. Peptide sequence LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene XRN1
Conjugate Unconjugated
Supplier Page Shop

Product images