LSM6 Antibody

Name LSM6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57318
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LSM6(LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)) The peptide sequence was selected from the N terminal of LSM6. Peptide sequence MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LSM6
Conjugate Unconjugated
Supplier Page Shop

Product images