THOC3 Antibody

Name THOC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57297
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to THOC3(THO complex 3) The peptide sequence was selected from the middle region of THOC3. Peptide sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene THOC3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.