DDX25 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57341
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DDX25 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 25) The peptide sequence was selected from the C terminal of DDX25. Peptide sequence TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DDX25
• Conjugate: Unconjugated