LSM6 Antibody

Name LSM6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57519
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Zebrafish
Antigen Synthetic peptides corresponding to LSM6 (LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM6)(50ug). Peptide sequence YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYIS
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene LSM6
Supplier Page Shop

Product images