TNRC6B Antibody

Name TNRC6B Antibody
Supplier Novus Biologicals
Catalog NBP1-57461
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TNRC6B(trinucleotide repeat containing 6B) The peptide sequence was selected from the N terminal of TNRC6B. Peptide sequence LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TNRC6B
Conjugate Unconjugated
Supplier Page Shop

Product images