LARP6 Antibody

Name LARP6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57460
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LARP6
Conjugate Unconjugated
Supplier Page Shop

Product images