TRA2B Antibody
| Name | TRA2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57457 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) The peptide sequence was selected from the middle region of SFRS10. Peptide sequence GVFGLSLYTTERDLREVFSKYGPIADVSIVY |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TRA2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TRA2B Antibody [NBP1-57457] - 293T cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14489_TRA2B-Antibody-Western-Blot-NBP1-57457-img0001.jpg)
![Immunohistochemistry-Paraffin: TRA2B Antibody [NBP1-57457] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14491_TRA2B-Antibody-Immunohistochemistry-Paraffin-NBP1-57457-img0002.jpg)