Name | TRA2B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57457 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) The peptide sequence was selected from the middle region of SFRS10. Peptide sequence GVFGLSLYTTERDLREVFSKYGPIADVSIVY |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | TRA2B |
Conjugate | Unconjugated |
Supplier Page | Shop |