PTBP2 Antibody

Name PTBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57401
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTBP2 (polypyrimidine tract binding protein 2) The peptide sequence was selected from the N terminal of PTBP2 (BAB71743). Peptide sequence MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PTBP2
Conjugate Unconjugated
Supplier Page Shop

Product images