CCBL2 Antibody

Name CCBL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57482
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCBL2
Conjugate Unconjugated
Supplier Page Shop

Product images