Deleted in azoospermia 4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57481
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DAZ4 (deleted in azoospermia 4) The peptide sequence was selected from the N terminal of DAZ4. Peptide sequence MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DAZ4
• Conjugate: Unconjugated