Name | ALKBH3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57586 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to ALKBH3(alkB, alkylation repair homolog 3 (E. coli)) The peptide sequence was selected from the middle region of ALKBH3. Peptide sequence EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ALKBH3 |
Supplier Page | Shop |