ALKBH3 Antibody

Name ALKBH3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57586
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to ALKBH3(alkB, alkylation repair homolog 3 (E. coli)) The peptide sequence was selected from the middle region of ALKBH3. Peptide sequence EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ALKBH3
Supplier Page Shop

Product images