CNOT6 Antibody

Name CNOT6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57550
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CNOT6(CCR4-NOT transcription complex, subunit 6) The peptide sequence was selected from the N terminal of CNOT6. Peptide sequence EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNOT6
Conjugate Unconjugated
Supplier Page Shop

Product images