FAM116A Antibody

Name FAM116A Antibody
Supplier Novus Biologicals
Catalog NBP1-56753
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM116A(family with sequence similarity 116, member A) The peptide sequence was selected from the middle region of FAM116A. Peptide sequence KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DENND6A
Conjugate Unconjugated
Supplier Page Shop

Product images