RAB3IP Antibody
| Name | RAB3IP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56745 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB3IP(RAB3A interacting protein (rabin3)) The peptide sequence was selected from the N terminal of RAB3IP. Peptide sequence APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB3IP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAB3IP Antibody [NBP1-56745] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: NCI-H226 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24592_RAB3IP-Antibody-Western-Blot-NBP1-56745-img0003.jpg)
Western Blot: RAB3IP Antibody [NBP1-56745] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: NCI-H226 cell lysate
![Immunohistochemistry: RAB3IP Antibody [NBP1-56745] - Mouse retina tissue Dilution: 1: 200 Secondary antibody: Goat anti-rabbit Alexafluor 568 Secondary antibody dilution: 1: 200 - See more at:](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24593_RAB3IP-Antibody-Immunohistochemistry-NBP1-56745-img0004.jpg)
Immunohistochemistry: RAB3IP Antibody [NBP1-56745] - Mouse retina tissue Dilution: 1: 200 Secondary antibody: Goat anti-rabbit Alexafluor 568 Secondary antibody dilution: 1: 200 - See more at: