17 beta-HSD14/HSD17B14 Antibody

Name 17 beta-HSD14/HSD17B14 Antibody
Supplier Novus Biologicals
Catalog NBP1-56863
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the N terminal of HSD17B14. Peptide sequence RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HSD17B14
Conjugate Unconjugated
Supplier Page Shop

Product images