TPRKB Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56860
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TPRKB(TP53RK binding protein) The peptide sequence was selected from the middle region of TPRKB. Peptide sequence EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TPRKB
• Conjugate: Unconjugated

Product images

Western Blot: TPRKB Antibody [NBP1-56860] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.