PEPD Antibody

Name PEPD Antibody
Supplier Novus Biologicals
Catalog NBP1-56815
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to PEPD(peptidase D) The peptide sequence was selected from the middle region of PEPD. Peptide sequence LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PEPD
Supplier Page Shop

Product images