Name | PEPD Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56815 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to PEPD(peptidase D) The peptide sequence was selected from the middle region of PEPD. Peptide sequence LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PEPD |
Supplier Page | Shop |