Name | RAPGEF3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57045 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3. Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RAPGEF3 |
Supplier Page | Shop |