RAPGEF3 Antibody

Name RAPGEF3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57045
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3. Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RAPGEF3
Supplier Page Shop

Product images