ATP8B2 Antibody

Name ATP8B2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57019
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP8B2 (ATPase, class I, type 8B, member 2) The peptide sequence was selected from the N terminal of ATP8B2. Peptide sequence KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP8B2
Conjugate Unconjugated
Supplier Page Shop

Product images