RIC8A Antibody

Name RIC8A Antibody
Supplier Novus Biologicals
Catalog NBP1-57011
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of RIC8A. Peptide sequence KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKG
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RIC8A
Supplier Page Shop

Product images