Name | RAB11FIP2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57009 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RAB11FIP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |