RAB11FIP2 Antibody

Name RAB11FIP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57009
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB11FIP2
Conjugate Unconjugated
Supplier Page Shop

Product images