Name | CHMP4B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56995 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CHMP4B (chromatin modifying protein 4B) The peptide sequence was selected from the middle region of CHMP4B. Peptide sequence RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CHMP4B |
Conjugate | Unconjugated |
Supplier Page | Shop |