CHMP4B Antibody

Name CHMP4B Antibody
Supplier Novus Biologicals
Catalog NBP1-56995
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHMP4B (chromatin modifying protein 4B) The peptide sequence was selected from the middle region of CHMP4B. Peptide sequence RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHMP4B
Conjugate Unconjugated
Supplier Page Shop

Product images