HSD3B7 Antibody

Name HSD3B7 Antibody
Supplier Novus Biologicals
Catalog NBP1-56994
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7) The peptide sequence was selected from the middle region of HSD3B7. Peptide sequence QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTK
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HSD3B7
Conjugate Unconjugated
Supplier Page Shop

Product images