NSDHL Antibody

Name NSDHL Antibody
Supplier Novus Biologicals
Catalog NBP1-59799
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NSDHL(NAD(P) dependent steroid dehydrogenase-like) The peptide sequence was selected from the middle region of NSDHL. Peptide sequence RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene NSDHL
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.