beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody
| Name | beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59853 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to B3GAT3 (beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)) The peptide sequence was selected from the N terminal of B3GAT3)(50ug). Peptide sequence PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B3GAT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody [NBP1-59853] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16397_beta-1-3-Glucuronyltransferase-3-B3GAT3-Antibody-Western-Blot-NBP1-59853-img0002.jpg)
Western Blot: beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody [NBP1-59853] - 721_B cell lysate, concentration 0.2-1 ug/ml.