Name | SLC7A2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59872 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC7A2(solute carrier family 7 (cationic amino acid transporter, y+ system), member 2) The peptide sequence was selected from the middle region of SLC7A2 (NP_001008539). Peptide sequence VANWKISEEFLKNISASAREPPSENGTSIYG |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC7A2 |
Conjugate | Unconjugated |
Supplier Page | Shop |