SLC7A2 Antibody

Name SLC7A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59872
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC7A2(solute carrier family 7 (cationic amino acid transporter, y+ system), member 2) The peptide sequence was selected from the middle region of SLC7A2 (NP_001008539). Peptide sequence VANWKISEEFLKNISASAREPPSENGTSIYG
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC7A2
Conjugate Unconjugated
Supplier Page Shop

Product images