ATP6V0A1 Antibody

Name ATP6V0A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59949
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6V0A1(ATPase, H+ transporting, lysosomal V0 subunit a1) The peptide sequence was selected from the N terminal of ATP6V0A1. Peptide sequence RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP6V0A1
Conjugate Unconjugated
Supplier Page Shop

Product images