DEGS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59941
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DEGS1(degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)) The peptide sequence was selected from the N terminal of DEGS1 (NP_003667). Peptide sequence GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIM
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DEGS1
• Conjugate: Unconjugated