Integrin alpha 8 Antibody

Name Integrin alpha 8 Antibody
Supplier Novus Biologicals
Catalog NBP1-59940
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ITGA8(integrin, alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ITGA8
Conjugate Unconjugated
Supplier Page Shop

Product images